DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and Creb3

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001382561.1 Gene:Creb3 / 298400 RGDID:1308831 Length:387 Species:Rattus norvegicus


Alignment Length:220 Identity:53/220 - (24%)
Similarity:81/220 - (36%) Gaps:82/220 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 PCKIKPEPNTQHPEDSDESLSDDDSQHHRSELTRRPSYNKIFTEISGPDMSGASLPMSDGVLNSQ 230
            |..::..|:    |:|.:.|||.:.:...|.|. .||        |.||:..:|   |..:|:..
  Rat    50 PLDLELSPS----ENSVQELSDWEVEDLLSSLL-SPS--------SSPDVLNSS---SSSILHDH 98

  Fly   231 LAGTGAGGNAANSSLMQ------LDP-------------------------TYYLSNRMSYNTNN 264
                       |.||.|      |||                         |..|:.........
  Rat    99 -----------NYSLPQEHVSIDLDPGSFEKEGFRMNPLRVEETAAEQELSTLILTEEEKRLLEK 152

  Fly   265 SGI----------AEDQTRKREIRLQKNREAARECRRKKKEYIKCLE--------------NRVA 305
            .|:          .|:|..||..|..:|:.||:|.|:|||.|:..||              |:|.
  Rat   153 EGLTLPSTLPLTKVEEQVLKRVRRKIRNKRAAQESRKKKKVYVVGLESRVLKYTAQNQELQNKVQ 217

  Fly   306 VLENQNKALIEELKSLKELYCQTKN 330
            .||.||.:|:::|:.|:.:..:..|
  Rat   218 HLEEQNLSLLDQLRKLQAMVTEIAN 242



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338142
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.