DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and Creb3l1

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_036087.2 Gene:Creb3l1 / 26427 MGIID:1347062 Length:520 Species:Mus musculus


Alignment Length:258 Identity:65/258 - (25%)
Similarity:100/258 - (38%) Gaps:84/258 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 QQQQA-------LAAATAMQKVVYVAKP--------PNSTVIHTTPGNAVQVR------------ 158
            :|:|:       |||::||.....:|.|        |...:.|..||...|:.            
Mouse   129 KQEQSPELPVDPLAASSAMAAAAAMATPPLLGLSPMPRLPIPHQAPGEMTQLPVIKAEPPEMSQF 193

  Fly   159 NKIPPTFPCKIKPEPNTQHPEDSDESLSDDDSQHHRSELTRRP------SYNKIFTE--ISGP-D 214
            .|:.|....::.|.|.:.|..||      |.||..||.....|      |...|.|.  ::.| .
Mouse   194 LKVTPEDLVQMPPTPPSSHGSDS------DGSQSPRSLPPSSPVRPMARSSTAISTSPLLTAPHK 252

  Fly   215 MSGASLPMSDGVLNSQ----LAGTGAGGNAANSSLMQLDPTYYLSNRMSYNTNNSGIAEDQTRKR 275
            :.|.|.|:   :|..:    |...|                |.:..::....     ||::..||
Mouse   253 LQGTSGPL---LLTEEEKRTLIAEG----------------YPIPTKLPLTK-----AEEKALKR 293

  Fly   276 EIRLQKNREAARECRRKKKEYIKCLE--------------NRVAVLENQNKALIEELKSLKEL 324
            ..|..||:.:|:|.|||||||::|||              .:|..||..|:.|:::|:.|:.|
Mouse   294 VRRKIKNKISAQESRRKKKEYVECLEKKVETYTSENNELWKKVETLETANRTLLQQLQKLQTL 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
Creb3l1NP_036087.2 Required for transcription activation. /evidence=ECO:0000250|UniProtKB:Q96BA8 1..60
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..259 17/64 (27%)
bZIP_CREB3 291..344 CDD:269837 20/52 (38%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 292..321 17/28 (61%)
coiled coil 293..344 CDD:269837 19/50 (38%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 332..353 6/20 (30%)
S2P recognition. /evidence=ECO:0000250|UniProtKB:Q96BA8 392..395
S1P recognition. /evidence=ECO:0000250|UniProtKB:Q96BA8 423..426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834572
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.