DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and Crem

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001104330.1 Gene:Crem / 25620 RGDID:2402 Length:357 Species:Rattus norvegicus


Alignment Length:291 Identity:95/291 - (32%)
Similarity:119/291 - (40%) Gaps:110/291 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 PNSTVIHTTPGNAVQVRNKIPPTFPCKIKPEPNTQHPE-----DSDESLSDD--DSQHHRSELTR 199
            |..|::....|..|||:..|....|..|: .|..|..:     ::|:|...:  ||...|..|:|
  Rat    67 PAVTLVQLPSGQTVQVQGVIQTPHPSVIQ-SPQIQTVQVATIAETDDSADSEVIDSHKRREILSR 130

  Fly   200 RPSYNKIFTEISGPDMSG---------------------------------------------AS 219
            ||||.||..|:|. |:.|                                             .|
  Rat   131 RPSYRKILNELSS-DVPGIPKIEEEKSEEEGTPPNIATMAVPTSIYQTSTGQYIAIAQGGTIQIS 194

  Fly   220 LPMSDGVLNSQ-LAGTGAGGNAANSSLMQLD---------------------------------- 249
            .|.||||...| |..|.:|.....::::|..                                  
  Rat   195 NPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETDLAPSHMAAA 259

  Fly   250 ----PTYYLSNRMSYNTNNSGI---------------AEDQTRKREIRLQKNREAARECRRKKKE 295
                |||.:  |........|:               ||:.|||||:||.|||||||||||||||
  Rat   260 TGDMPTYQI--RAPTTALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAARECRRKKKE 322

  Fly   296 YIKCLENRVAVLENQNKALIEELKSLKELYC 326
            |:|||||||||||||||.||||||:||:|||
  Rat   323 YVKCLENRVAVLENQNKTLIEELKALKDLYC 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
CremNP_001104330.1 pKID 112..151 CDD:396650 16/39 (41%)
bZIP_CREB1 301..355 CDD:269838 47/53 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338144
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4265
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407205at33208
OrthoFinder 1 1.000 - - FOG0001658
OrthoInspector 1 1.000 - - otm45127
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45879
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1385
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.090

Return to query results.
Submit another query.