DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and atf31

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_593039.1 Gene:atf31 / 2541860 PomBaseID:SPAC22F3.02 Length:209 Species:Schizosaccharomyces pombe


Alignment Length:143 Identity:38/143 - (26%)
Similarity:63/143 - (44%) Gaps:36/143 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 LSDDDSQHHRSELTRRPSYN---KIFTEISGPDMSGASLPMSDGVLNSQLAGTGAGGNAANSSLM 246
            |.||     ||.:...| ||   ..|.|:|....|.:...:|:...||                 
pombe    62 LGDD-----RSPINNDP-YNIRRSDFDELSEYTASKSPSIISEASHNS----------------- 103

  Fly   247 QLDPTYYLSNRMSYNTNN-SGIAEDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVAVLENQ 310
               |:..|.:....||:. :|..:...:.|      ||:||::||.|||:|::.|:::|....::
pombe   104 ---PSRELDDSGDENTSKLTGTKQSMLKAR------NRQAAQKCRIKKKKYLQTLQDQVNYYTSE 159

  Fly   311 NKALIEELKSLKE 323
            ||.|::....|:|
pombe   160 NKELLQSANDLRE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
atf31NP_593039.1 bZIP_ATF2 123..183 CDD:269835 18/56 (32%)
coiled coil 123..183 CDD:269835 18/56 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.