DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and atf1

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001342974.1 Gene:atf1 / 2540329 PomBaseID:SPBC29B5.01 Length:566 Species:Schizosaccharomyces pombe


Alignment Length:338 Identity:77/338 - (22%)
Similarity:137/338 - (40%) Gaps:78/338 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NGNSSAASGSNDVVDVVAQQAAAAVGGGGGGGGGGGGGNPQQQQQNPQSTTAGGPTGATNNAQGG 73
            ||:.|...|:|..|..:...:..                |.|||:..|      |..:.|:    
pombe   262 NGDQSDYFGANAAVHGLCLLSQV----------------PDQQQKLQQ------PISSEND---- 300

  Fly    74 GVSSVLTTTANCNIQYPIQTLAQHGLQVQSVIQANPSGVIQTAAGTQQQQQALAAATAMQKVVYV 138
               ...:||||..::...|......::.......||    |...||...|   |:.|..|.:.::
pombe   301 ---QAASTTANNLLKQTQQQTFPDSIRPSFTQNTNP----QAVTGTMNPQ---ASRTQQQPMYFM 355

  Fly   139 AKPPNSTVIHTTPGNAVQVRNKIPPTFPCKIKP-EPNTQHPEDSDESLSDDDSQHHRSELTRR-- 200
            ..               |..|.:|..:...:.| :|:....:.:|  .|..::::..:.|.::  
pombe   356 GS---------------QQFNGMPSVYGDTVNPADPSLTLRQTTD--FSGQNAENGSTNLPQKTS 403

  Fly   201 ----PSYNKIFTEI-SGPDMSGASLPMSDGVLNSQLAGTGA-GGNAANSSLMQLDPTYYLSNRMS 259
                |:.|.:..:: :|.|.|.:..|.|:.  |:|.:.|.: .|.|::.|   .:.|.|......
pombe   404 NSDMPTANSMPVKLENGTDYSTSQEPSSNA--NNQSSPTSSINGKASSES---ANGTSYSKGSSR 463

  Fly   260 YNTNNSGIAEDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVAVLENQNK-------ALIEE 317
            .|:.|    |....||:..|::||:||.:||::||:::..|:.:|....|:|:       ||.||
pombe   464 RNSKN----ETDEEKRKSFLERNRQAALKCRQRKKQWLSNLQAKVEFYGNENEILSAQVSALREE 524

  Fly   318 LKSLKELYCQTKN 330
            :.|||.|....|:
pombe   525 IVSLKTLLIAHKD 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
atf1NP_001342974.1 Aft1_HRA 152..234 CDD:314623
Macoilin <280..>532 CDD:313022 69/313 (22%)
bZIP_ATF2 474..534 CDD:269835 23/59 (39%)
coiled coil 474..534 CDD:269835 23/59 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.