DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and Creb5

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_036021932.1 Gene:Creb5 / 231991 MGIID:2443973 Length:508 Species:Mus musculus


Alignment Length:355 Identity:75/355 - (21%)
Similarity:115/355 - (32%) Gaps:85/355 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VGGGGGGGGGGGGGNP-----------QQQQQNPQSTTAGGPTGATNNAQG---GGVSSVL---- 79
            |||...|.|....|:.           ||...:|||::......:||...|   |.:||:|    
Mouse   105 VGGTMTGPGAHQLGSTRMPNHDSSVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHN 169

  Fly    80 -----------------TTTANCNIQYPIQTLAQHGLQVQSVIQANPSGVIQTAAGTQQQQQALA 127
                             |...:..:..|:    :..:.|.|.|.......:.....:.|.|...:
Mouse   170 RQRQPMPASMPGTLPNPTMPGSSAVLMPM----ERQMSVNSSIMGMQGPNLSNPCASPQVQPMHS 230

  Fly   128 AATAMQKVVYVAKPP------NSTVIH----------TTPGNAV----QVRNKIPPTFPCKIKPE 172
            .|....|......|.      .||:.|          .||.:.:    .....:||..|...:.:
Mouse   231 EAKMRLKAALTHHPAAMSNGNMSTIGHMMEMMGSRQDQTPHHHLHSHPHQHQTLPPHHPYPHQHQ 295

  Fly   173 PNTQHPEDSDESLSDDDSQHHRSELTRRPSYNKIFTEISGPDMSGASLPMSDGVLNSQLAGTGAG 237
            ....||........:....|..|.|...|::::  |....|      ||.               
Mouse   296 HPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQ--TSPHPP------LPT--------------- 337

  Fly   238 GNAANSS--LMQLDPTYYLS-NRMSYNTNNSGIAEDQTRKREIRLQKNREAARECRRKKKEYIKC 299
            ||.|..|  ..|:.||..:. .:.:.......:.||...:|...|::||.||..||:|:|.::..
Mouse   338 GNQAQVSPATQQMQPTQTIQPPQPTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMS 402

  Fly   300 LENRVAVLENQNKALIEELKSLKELYCQTK 329
            ||.:...|...|..|..|:..||....|.|
Mouse   403 LEKKAEELTQTNMQLQNEVSMLKNEVAQLK 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
Creb5XP_036021932.1 bZIP_ATF2 377..436 CDD:269835 20/56 (36%)
coiled coil 378..429 CDD:269835 18/50 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.