DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and Atf6

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001074773.1 Gene:Atf6 / 226641 MGIID:1926157 Length:656 Species:Mus musculus


Alignment Length:268 Identity:55/268 - (20%)
Similarity:100/268 - (37%) Gaps:78/268 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 NCNIQYPIQTL------------AQHGLQVQSVIQANPSGVIQTAAGTQQQQQALAAATAMQKVV 136
            :||....::.|            .:|||        .|...||.::....|.:.|....|.:...
Mouse   125 SCNSPSSVEPLKEEKPVTGPGNKTEHGL--------TPKKKIQMSSKPSVQPKPLLLPAAPKTQT 181

  Fly   137 YVAKPPNSTVIHTTPGNAVQVRNKIPPTFP-------CKIKPEPNTQHPEDSDESLSDDDSQHHR 194
            ..:.|..:.:|.|           :|...|       ..|:|.|.                 ..:
Mouse   182 NASVPAKAIIIQT-----------LPALMPLAKQQSIISIQPAPT-----------------KGQ 218

  Fly   195 SELTRRPSYNKIFTEISGPDMSGASLPMSDGVLNSQLAGTGAGGNAANSSLMQLDPTYYLSNRMS 259
            :.|..:|:    ..::..|.:..::.|:        ||.||......| .::.:.|...:|:.::
Mouse   219 TVLLSQPT----VVQLQSPAVLSSAQPV--------LAVTGGAAQLPN-HVVNVLPAPVVSSPVN 270

  Fly   260 YNTN-NSGIAEDQTR---------KREIRLQKNREAARECRRKKKEYIKCLENRVAVLENQNKAL 314
            ...: ...:.:..||         :|:.|:.||||:|.:.|:|||||:..||.|:....::|:.|
Mouse   271 GKLSVTKPVLQSATRSMGSDIAVLRRQQRMIKNRESACQSRKKKKEYMLGLEARLKAALSENEQL 335

  Fly   315 IEELKSLK 322
            .:|..|||
Mouse   336 KKENGSLK 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
Atf6NP_001074773.1 Transcription activation. /evidence=ECO:0000305 1..137 3/11 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..169 10/51 (20%)
Ribophorin_II <223..>298 CDD:368624 13/87 (15%)
Basic motif 295..326 16/30 (53%)
bZIP_ATF6 296..347 CDD:269848 22/48 (46%)
coiled coil 296..347 CDD:269848 22/48 (46%)
Leucine-zipper 335..342 2/6 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 391..429
Interaction with THBS4. /evidence=ECO:0000269|PubMed:22682248 455..575
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 632..656
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834562
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.