DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and Creb3l3

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001369747.1 Gene:Creb3l3 / 208677 MGIID:2384786 Length:479 Species:Mus musculus


Alignment Length:232 Identity:65/232 - (28%)
Similarity:93/232 - (40%) Gaps:68/232 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 PPNSTVIHTTPGNAV-------QVRNKIP---PTFPCKIKPE-PNTQHPEDS---DESLSDDDSQ 191
            ||.|   .|.|.|.|       |.:...|   |:.||   || |.||..|.|   |..:...|:.
Mouse   102 PPRS---GTEPANTVARCHTREQGKGPCPSYLPSTPC---PEPPRTQVQESSVAIDLDMWSTDTL 160

  Fly   192 HHRSELTRRPSYNKIFTEISGPDMSGASLPMSD-GVLNSQLAGTGAGG------NAANSSLM--- 246
            :..........:|....|:.   :||.|..:.. .:..|||.|.|:|.      ......|:   
Mouse   161 YPEEPAGSPSRFNLTVKELL---LSGGSGDLQQHSLAASQLLGPGSGHCQELVLTEDEKKLLAKE 222

  Fly   247 ------QLDPTYYLSNRMSYNTNNSGIAEDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVA 305
                  ||..|.|               |::..|:..|..:|:::|:|.|:||||||..||||::
Mouse   223 GVTLPTQLPLTKY---------------EERVLKKIRRKIRNKQSAQESRKKKKEYIDGLENRMS 272

  Fly   306 V--------------LENQNKALIEELKSLKELYCQT 328
            .              ||.||.:|:|:||.|:.|..|:
Mouse   273 ACTAQNQELQRKVLHLEKQNLSLLEQLKHLQALVVQS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
Creb3l3NP_001369747.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..144 17/47 (36%)
bZIP_CREB3 240..300 CDD:269837 22/59 (37%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 241..270 14/28 (50%)
coiled coil 242..293 CDD:269837 18/50 (36%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 281..302 8/20 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834570
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.