DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and fos-1

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001033481.1 Gene:fos-1 / 178987 WormBaseID:WBGene00001345 Length:467 Species:Caenorhabditis elegans


Alignment Length:298 Identity:62/298 - (20%)
Similarity:101/298 - (33%) Gaps:99/298 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 QNPQSTTAGGPTGATNNAQGGGVSSVLTTTANCNIQYPIQTLAQHGLQV---QSVIQANPSGVIQ 114
            :.|.|||      .|..:.|.|..|                  .|..::   ..:.||:|:.|| 
 Worm     3 EQPSSTT------NTTTSSGSGSDS------------------NHYFELGPRNPINQAHPTSVI- 42

  Fly   115 TAAGTQQQQQALAAATAMQKVVYVAKPPNSTVIHTT---PGNA-----------VQVRNKIPPTF 165
             ....|...|           ::..:..||.:...|   |.||           :|.:   |...
 Worm    43 -VPPRQHHHQ-----------IHQQQTDNSPLTPCTPYYPSNAYGLPLFFGTDFLQFQ---PSDI 92

  Fly   166 PCKIKP---EPNTQHPEDSDESLSDDDSQHHRSELTRRPSYNKIFTEISGPDMSGASLPMSDGVL 227
            |..:.|   .|.|.||.....::..:.            .||:.||:...   :.||.||   |.
 Worm    93 PSPLTPNISSPLTPHPFGPIPAIPTNQ------------IYNRTFTDFYS---TAASSPM---VQ 139

  Fly   228 NSQLAGTGAGGNAANSSLMQLDPTYYLSNRMSYNTNNSGIAEDQTRKREIRLQKNREAARECRRK 292
            .|.:..:.||........|:                     :|...||..|.|:|:|||..||::
 Worm   140 YSTVKKSSAGRKPKEEDNME---------------------DDDDDKRLKRRQRNKEAAARCRQR 183

  Fly   293 KKEYIKCLENRVAVLENQNKALIEELKSLKELYCQTKN 330
            :.:.:|.|:::|...:|.|...:.|..:::......||
 Worm   184 RIDLMKELQDQVNDFKNSNDKKMAECNNIRNKLNSLKN 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
fos-1NP_001033481.1 bZIP_Fos_like 165..223 CDD:269847 18/57 (32%)
coiled coil 166..223 CDD:269847 17/56 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.