DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and CREB3L4

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_001242907.1 Gene:CREB3L4 / 148327 HGNCID:18854 Length:395 Species:Homo sapiens


Alignment Length:224 Identity:53/224 - (23%)
Similarity:93/224 - (41%) Gaps:65/224 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 KIKPEPN----TQHPEDSDESLSDDDSQHHRSELTRRPSYNKIFTEI-------------SGPDM 215
            |:..:||    ::....||..:|:|.. |..|....|.:.:.:..|:             :||::
Human    70 KLFIDPNEVYCSEASPGSDSGISEDPC-HPDSPPAPRATSSPMLYEVVYEAGALERMQGETGPNV 133

  Fly   216 SGASLPMS---------DGVLNSQL-----------AGTGAGGNAANSSLMQLDPTYYLSNRMSY 260
            ...|:.:.         |..:.|:|           |||.|  ....::|:... |.:|::....
Human   134 GLISIQLDQWSPAFMVPDSCMVSELPFDAHAHILPRAGTVA--PVPCTTLLPCQ-TLFLTDEEKR 195

  Fly   261 NTNNSGI----------AEDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVAV--------- 306
            .....|:          ||::..|:..|..:|:::|::.||:|||||..||:|||.         
Human   196 LLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKEYIDGLESRVAACSAQNQELQ 260

  Fly   307 -----LENQNKALIEELKSLKELYCQTKN 330
                 ||..|.:|:.:|:.|:.|..||.|
Human   261 KKVQELERHNISLVAQLRQLQTLIAQTSN 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
CREB3L4NP_001242907.1 PCC 77..>154 CDD:188093 12/77 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..108 7/26 (27%)
bZIP_CREB3 218..278 CDD:269837 20/59 (34%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 219..248 13/28 (46%)
coiled coil 220..271 CDD:269837 17/50 (34%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 259..280 5/20 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..395
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144436
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.