DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and Fosl2

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_032063.2 Gene:Fosl2 / 14284 MGIID:102858 Length:326 Species:Mus musculus


Alignment Length:265 Identity:51/265 - (19%)
Similarity:86/265 - (32%) Gaps:105/265 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 TAGGPTGATNNAQGGGVSSVLTTTANCNIQYPIQTLAQHGLQVQSVIQANPSGVIQTAAGTQQQQ 123
            ::|.|..|.:.:.|||                    .|...:|.  :..:.|..|.|        
Mouse    16 SSGSPAHAESYSSGGG--------------------GQQKFRVD--MPGSGSAFIPT-------- 50

  Fly   124 QALAAATAMQKVVYVAKPPNSTVIHTTPGNAVQVRNKIPPTFPCKIKPEPNTQHPEDSDESLSDD 188
              :.|.|..|.:.::.:|   |||       ..:.|..|.:.|  ..|.|.              
Mouse    51 --INAITTSQDLQWMVQP---TVI-------TSMSNPYPRSHP--YSPLPG-------------- 87

  Fly   189 DSQHHRSELTRRPSYNKIFTEISGPDMSGASLPMSDGVLNSQLAGTGAGGNAANSSLMQLDPTYY 253
                    |...|.:              .:|| ..||:.:  .||..|....:.   ||.|   
Mouse    88 --------LASVPGH--------------MALP-RPGVIKT--IGTTVGRRRRDE---QLSP--- 121

  Fly   254 LSNRMSYNTNNSGIAEDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVAVLENQNKALIEEL 318
                            ::..||.||.::|:.||.:||.:::|..:.|:.....||.:...|.:|:
Mouse   122 ----------------EEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEI 170

  Fly   319 KSLKE 323
            ..|::
Mouse   171 AELQK 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
Fosl2NP_032063.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39 7/42 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..131 7/42 (17%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 126..128 1/1 (100%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 129..136 3/6 (50%)
bZIP_Fos 134..187 CDD:269869 12/42 (29%)
coiled coil 134..186 CDD:269869 12/42 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..244
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..326
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.