DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and Fosl1

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_034365.1 Gene:Fosl1 / 14283 MGIID:107179 Length:273 Species:Mus musculus


Alignment Length:60 Identity:20/60 - (33%)
Similarity:35/60 - (58%) Gaps:3/60 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 IAEDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVAVLENQNKAL---IEELKSLKE 323
            |:.::..:|.:|.::|:.||.:||.::||....|:.....||::...|   ||||:..||
Mouse   100 ISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKE 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
Fosl1NP_034365.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..114 3/13 (23%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 107..127 7/19 (37%)
bZIP_Fos 115..168 CDD:269869 17/45 (38%)
coiled coil 115..167 CDD:269869 17/45 (38%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 133..161 10/27 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..273
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.