DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and CREM

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_024303592.1 Gene:CREM / 1390 HGNCID:2352 Length:360 Species:Homo sapiens


Alignment Length:350 Identity:107/350 - (30%)
Similarity:143/350 - (40%) Gaps:120/350 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 QYPIQTL-AQHGLQVQSVIQANPSGVIQTAAGTQQQQQALAAATAMQKVVYVA------KPPNST 145
            |..::|: :||...:.:.:..:.|..:||..| |....|||.       |.||      ..|..|
Human    16 QMTMETVESQHDGSITASLTESKSAHVQTQTG-QNSIPALAQ-------VSVAGSGTRRGSPAVT 72

  Fly   146 VIHTTPGNAVQVRNKIPPTFPCKIK-PEPNTQHP---EDSDESLSDD---DSQHHRSELTRRPSY 203
            ::....|..:.|:..|....|..|: .|.:|...   .::|||...:   ||...|..|:|||||
Human    73 LVQLPSGQTIHVQGVIQTPQPWVIQSSEIHTVQVAAIAETDESAESEGVIDSHKRREILSRRPSY 137

  Fly   204 NKIFTEISGPDMSGA---------------------------------------------SLPMS 223
            .||..|:|. |:.|.                                             |.|.|
Human   138 RKILNELSS-DVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGS 201

  Fly   224 DGVLNSQ-LAGTGAGGNAANSSLMQL----------------------DPTYYLSNRMSYNTNN- 264
            |||...| |..|.:|.....::::|.                      :.|....:.|:..|.: 
Human   202 DGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFVPGSQVVVQDEETELAPSHMAAATGDM 266

  Fly   265 ----------------------------SGIAEDQTRKREIRLQKNREAARECRRKKKEYIKCLE 301
                                        ..:||:.|||||:||.||||||||||||||||:||||
Human   267 PTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAARECRRKKKEYVKCLE 331

  Fly   302 NRVAVLENQNKALIEELKSLKELYC 326
            |||||||||||.||||||:||:|||
Human   332 NRVAVLENQNKTLIEELKALKDLYC 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
CREMXP_024303592.1 pKID 117..154 CDD:308015 15/37 (41%)
bZIP_CREB1 304..358 CDD:269838 46/52 (88%)
coiled coil 305..357 CDD:269838 45/51 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144434
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4360
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407205at33208
OrthoFinder 1 1.000 - - FOG0001658
OrthoInspector 1 1.000 - - otm40992
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1385
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.