DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and Atf6b

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_059102.2 Gene:Atf6b / 12915 MGIID:105121 Length:706 Species:Mus musculus


Alignment Length:275 Identity:59/275 - (21%)
Similarity:98/275 - (35%) Gaps:80/275 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 IQYPIQTLAQHGLQVQSVIQ-ANPSGVIQTAA---GTQQQQQALAAATAMQKVVYVAKPPNSTVI 147
            :|..:.:.:.....:|:.:: |:||..:.:.|   ......|.......::.......|| ..::
Mouse   151 VQITVGSASDDLSDIQTKLEPASPSSSVHSEASLLSADSPSQPFIGEEVLEVKTESPSPP-GCLL 214

  Fly   148 HTTPGN---AVQVRNKIPPTFPCKIKPEPNTQHPEDSDESLSDDDSQHHRSELTRRPSYNK---I 206
            ...|.:   |||:          .:.|.|               ||...::..||:|....   :
Mouse   215 WDVPASSLGAVQI----------SMGPSP---------------DSSSGKAPATRKPPLQPKPVV 254

  Fly   207 FTEISGPDMSGASLPMSDGVLNSQLAGTGAGGNAANSSLMQLDPTYYLSNRMSYNTNNSGIA--- 268
            .|.:..|..:|   |.|..||...|....|           :.|...:...:.........|   
Mouse   255 LTTVPVPPRAG---PTSAAVLLQPLVQQPA-----------VSPVVLIQGAIRVQPEGPAPAAPR 305

  Fly   269 --------------------EDQTRKREIRLQKNREAARECRRKKKEYIKCLENRV-AVL-ENQ- 310
                                :.:..||:.|:.||||:|.:.|||||||::.||.|: ||| :|| 
Mouse   306 PERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAVLADNQQ 370

  Fly   311 ----NKALIEELKSL 321
                |.||...|::|
Mouse   371 LRRENAALRRRLEAL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
Atf6bNP_059102.2 bZIP_ATF6 332..383 CDD:269848 25/50 (50%)
coiled coil 332..383 CDD:269848 25/50 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834546
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.