| Sequence 1: | NP_001334685.1 | Gene: | CrebB / 32817 | FlyBaseID: | FBgn0265784 | Length: | 331 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_031523.3 | Gene: | Atf1 / 11908 | MGIID: | 1298366 | Length: | 269 | Species: | Mus musculus |
| Alignment Length: | 275 | Identity: | 85/275 - (30%) |
|---|---|---|---|
| Similarity: | 112/275 - (40%) | Gaps: | 101/275 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 130 TAMQKVVYVAKPPNSTVIHTTPGNAVQVRNKIPPTFPCKIKPEPNTQHPEDSDESLSDDDSQHHR 194
Fly 195 SELTRRPSYNKIFTEISGPDMSG----------------------------------------AS 219
Fly 220 LPMSDGV--------LNS---------QLAGTGAGGN---AANSSLMQ----------------- 247
Fly 248 --LDPTYYLSNRMSYNTNNSGIAEDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVAVLENQ 310
Fly 311 NKALIEELKSLKELY 325 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CrebB | NP_001334685.1 | None | |||
| Atf1 | NP_031523.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..90 | 23/98 (23%) | |
| pKID | 48..82 | CDD:366954 | 12/35 (34%) | ||
| bZIP_CREB1 | 213..267 | CDD:269838 | 47/53 (89%) | ||
| Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 213..237 | 22/24 (92%) | |||
| coiled coil | 214..266 | CDD:269838 | 46/51 (90%) | ||
| Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 239..260 | 19/20 (95%) | |||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167834549 | |
| Domainoid | 1 | 1.000 | 100 | 1.000 | Domainoid score | I6999 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 152 | 1.000 | Inparanoid score | I4331 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D407205at33208 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0001658 | |
| OrthoInspector | 1 | 1.000 | - | - | otm43063 | |
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR45879 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R103 |
| SonicParanoid | 1 | 1.000 | - | - | X1385 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 10 | 10.120 | |||||