| Sequence 1: | NP_001334685.1 | Gene: | CrebB / 32817 | FlyBaseID: | FBgn0265784 | Length: | 331 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_006359.3 | Gene: | CREB3 / 10488 | HGNCID: | 2347 | Length: | 371 | Species: | Homo sapiens |
| Alignment Length: | 195 | Identity: | 43/195 - (22%) |
|---|---|---|---|
| Similarity: | 74/195 - (37%) | Gaps: | 60/195 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 159 NKIPPTFPCKIKPEPNTQHPEDS------DESLSDDDSQ---HHRSELTRRPSYNKIFTEISGPD 214
Fly 215 MSGASLPMSDGVLNSQLAGTGAGGNAANSSLMQLDPTYYLSNRMSYNTNNSGIAEDQTRKREIRL 279
Fly 280 QKNREAARECRRKKKEYIKCLE--------------NRVAVLENQNKALIEELKSLKELYCQTKN 330
Fly 331 330 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CrebB | NP_001334685.1 | None | |||
| CREB3 | NP_006359.3 | Transcription activation (acidic). /evidence=ECO:0000269|PubMed:10984507 | 1..92 | 4/26 (15%) | |
| LXXLL motif 1 | 13..17 | ||||
| LXXLL motif 2 | 54..58 | ||||
| HCFC1-binding-motif (HBM) | 78..81 | 0/2 (0%) | |||
| GlgA | 85..>222 | CDD:333024 | 38/173 (22%) | ||
| bZIP_CREB3 | 151..211 | CDD:269837 | 21/59 (36%) | ||
| Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 152..184 | 14/31 (45%) | |||
| coiled coil | 153..204 | CDD:269837 | 18/50 (36%) | ||
| Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 192..213 | 8/20 (40%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165144432 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||