DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and creb3l3b

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_009297197.2 Gene:creb3l3b / 100538072 ZFINID:ZDB-GENE-131023-1 Length:388 Species:Danio rerio


Alignment Length:70 Identity:25/70 - (35%)
Similarity:40/70 - (57%) Gaps:14/70 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 EDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVAV--------------LENQNKALIEELK 319
            |::..|:..|..:|:::|:|.|:||||||..||.|:|.              ||..|.:|:|:|:
Zfish   201 EEKVLKKIRRKIRNKQSAQESRKKKKEYIDGLEGRMAACSAHNLDLQRKVLQLEKTNTSLMEQLR 265

  Fly   320 SLKEL 324
            .|:.|
Zfish   266 RLQAL 270



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577538
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.