DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and crem

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_002935208.1 Gene:crem / 100492439 XenbaseID:XB-GENE-986312 Length:102 Species:Xenopus tropicalis


Alignment Length:78 Identity:56/78 - (71%)
Similarity:65/78 - (83%) Gaps:5/78 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 MSYNTNN----SGIAEDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVAVLENQNKALIEEL 318
            :|.:|||    ..:||:.|||||:||.||||||||||:|||||:|||||||||||||||.|||||
 Frog    26 VSPSTNNLHNPQIMAEEVTRKRELRLLKNREAARECRKKKKEYVKCLENRVAVLENQNKTLIEEL 90

  Fly   319 KSLKELYCQTKND 331
            |:||:|||. |.|
 Frog    91 KALKDLYCH-KTD 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
cremXP_002935208.1 bZIP_CREB1 46..100 CDD:269838 46/54 (85%)
coiled coil 47..99 CDD:269838 44/51 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 100 1.000 Domainoid score I6899
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407205at33208
OrthoFinder 1 1.000 - - FOG0001658
OrthoInspector 1 1.000 - - otm48190
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.