DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrebB and atf2

DIOPT Version :9

Sequence 1:NP_001334685.1 Gene:CrebB / 32817 FlyBaseID:FBgn0265784 Length:331 Species:Drosophila melanogaster
Sequence 2:XP_009302699.1 Gene:atf2 / 100006516 ZFINID:ZDB-GENE-030911-8 Length:488 Species:Danio rerio


Alignment Length:340 Identity:70/340 - (20%)
Similarity:112/340 - (32%) Gaps:110/340 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 QQQNPQSTTAGGPTGATNNAQGGGVSSVLTTTANCNI-----QYPIQTLAQ-HGLQVQSVIQAN- 108
            ::|.|..:....|.....:          |||.:..:     ..|..|:.: ..|||.:|:.|| 
Zfish   106 EEQTPMESHRDSPLPHPES----------TTTDDKEVSLQPPSLPPSTIVRPPSLQVPNVLLANS 160

  Fly   109 PSGVIQTAAGTQQQQQALAAATAMQKVVYV---AKP--------------PNS-----TVIHTTP 151
            .:||:        .||||.:.|:...:.:|   ::|              ||.     .:..|..
Zfish   161 EAGVV--------IQQALPSPTSSSVITHVPSSSRPIVPVSGTFPVLLQLPNGQTMPVAIPATIA 217

  Fly   152 GNAVQVRNKIPPTFPCKIKPE------PNTQHPEDSD------ESLSDD----------DSQHHR 194
            .::|.:...||...|..:.|.      |.:..|..|:      .:||..          |.|...
Zfish   218 SSSVHIPTAIPLVRPVTVVPSVPGIPGPASPQPVQSEAKMKLKAALSQQIPQVTNGDAIDIQSSS 282

  Fly   195 SELT----------RRPSYNKIFTEISGPDMSGASLPMSDGVLNSQLAGTGAGGNAANSSLMQLD 249
            :..|          :||.      .:..|..|...:|:|..........||.......|      
Zfish   283 ASETPPPAPPPAEEQRPK------SLQQPATSTTEIPVSPAPPAQHTPSTGGRRRRTTS------ 335

  Fly   250 PTYYLSNRMSYNTNNSGIAEDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVAVLENQNKAL 314
                               ||...||...|::||.||..||:|:|.:::.||.:...|.:.|..|
Zfish   336 -------------------EDPDEKRRKFLERNRAAASRCRQKRKVWVQSLEKKAEDLSSVNGQL 381

  Fly   315 IEELKSLKELYCQTK 329
            ..|:..|:....|.|
Zfish   382 QNEVTLLRNEVAQLK 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrebBNP_001334685.1 None
atf2XP_009302699.1 C2H2 Zn finger 9..31 CDD:275370
GCN4_cent 47..84 CDD:213399
bZIP_ATF2 341..401 CDD:269835 20/56 (36%)
coiled coil 341..401 CDD:269835 20/56 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.