DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6123 and CG32700

DIOPT Version :9

Sequence 1:NP_001245739.1 Gene:CG6123 / 32815 FlyBaseID:FBgn0030913 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_727344.1 Gene:CG32700 / 31896 FlyBaseID:FBgn0267253 Length:218 Species:Drosophila melanogaster


Alignment Length:218 Identity:117/218 - (53%)
Similarity:135/218 - (61%) Gaps:28/218 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ISAPEPLIVVEESNLPEEQED------SSEPTV-----SNRGSLDIDSPVNPYLLSPWRDPREAR 97
            :|..|||||||||:..|:.:|      ..:||.     ||....:.|||||||||.|:.|.::.|
  Fly    12 LSTQEPLIVVEESHTAEDGDDLEGAAGGCDPTAAGTRRSNSDDSEPDSPVNPYLLCPFPDMQQRR 76

  Fly    98 KHSLPSQQVTDGITASQVRRLSERGGEGSGPTPKEAAFLATLSQAPAPT--GRRHSVVTISKVPT 160
            ||||||.|:|:||||||||||||.|||..|.:|||..|||||||...||  ||||||||||.||.
  Fly    77 KHSLPSLQITEGITASQVRRLSEVGGETGGLSPKEVEFLATLSQKANPTAGGRRHSVVTISAVPP 141

  Fly   161 TLFGRSRRESVAAYPNSNGSSRVLNSRRES-NTGPPSTDPIGSIHNLQLDIMDDIYLQSRKARLK 224
            |||||:||||::....|       .|||.| ..|||.||..||:|||||||||.| :|.||.|  
  Fly   142 TLFGRNRRESISGVSFS-------GSRRGSVIAGPPLTDHRGSVHNLQLDIMDGI-VQQRKTR-- 196

  Fly   225 LWTSSNEKVCEVQTVDEAGSGQP 247
                |...|.....:.||.|..|
  Fly   197 ----SGSGVWTAPVLQEADSNVP 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6123NP_001245739.1 RIO1 87..>206 CDD:224632 74/121 (61%)
CG32700NP_727344.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28NF7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014316
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.