DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33639 and GPR142

DIOPT Version :9

Sequence 1:NP_001027070.1 Gene:CG33639 / 32803 FlyBaseID:FBgn0053639 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_861455.1 Gene:GPR142 / 350383 HGNCID:20088 Length:462 Species:Homo sapiens


Alignment Length:376 Identity:75/376 - (19%)
Similarity:138/376 - (36%) Gaps:101/376 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 REYCYGLVLPII-----CAMGIIGNVLNLVVLTR--RNMRGTAYIYMRAYSTAALL---AIVFA- 112
            |..|...|:|:|     ..:|:..::|..|.|.|  ...|..:|.|:.|.:.:.::   .|||| 
Human   150 RSPCVAGVIPVIYYSVLLGLGLPVSLLTAVALARLATRTRRPSYYYLLALTASDIIIQVVIVFAG 214

  Fly   113 -----------IPFGIRMLVHKDRGQWEEFGPAFYTAHLELYLGNGCLGVGVMMLLVLTIERYVS 166
                       :|..:                 ..||::..:..|   ...|.:.::||::||.:
Human   215 FLLQGAVLARQVPQAV-----------------VRTANILEFAAN---HASVWIAILLTVDRYTA 259

  Fly   167 VCHPGFARPVMGPPGVVVFLTCLATVIVYLPSIFRGELIKCILGSSDVYVYLRRDNTIYQQTIFY 231
            :|||...|....|...   ...:|.|           |...:|.....|.:|    .:::.|...
Human   260 LCHPLHHRAASSPGRT---RRAIAAV-----------LSAALLTGIPFYWWL----DMWRDTDSP 306

  Fly   232 RVYKIMLEVIFKLVPTLVIGGLNMRIMMVYRRTCERRRKMVLSRPHAQGHGHGHGHGHGHGHGHA 296
            |.    |:.:.|....|.:..:...:.:|       ....::.|...:|..              
Human   307 RT----LDEVLKWAHCLTVYFIPCGVFLV-------TNSAIIHRLRRRGRS-------------- 346

  Fly   297 HGHGYLKDDDPRKFAEERRLFLLLGSTSILFLVCVSP---MAILHMTIASEVYPSFPFQVFRASA 358
               |.    .||   ..:...:|||.|: ||.:..:|   :.:.||.:| .|:..:...:....|
Human   347 ---GL----QPR---VGKSTAILLGITT-LFTLLWAPRVFVMLYHMYVA-PVHRDWRVHLALDVA 399

  Fly   359 NLLELINYSLTFYIYCLFSEDFRNTLVRTIKWPWLKGKFCHQAEHEVSASP 409
            |::.:::.:..|.:||..|:.||.|:.:.|...:|......|.| .::|.|
Human   400 NMVAMLHTAANFGLYCFVSKTFRATVRQVIHDAYLPCTLASQPE-GMAAKP 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33639NP_001027070.1 7tm_1 77..>278 CDD:278431 39/217 (18%)
GPR142NP_861455.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..123
7tm_1 176..414 CDD:278431 57/312 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157871
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.