DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33639 and Gpr139

DIOPT Version :9

Sequence 1:NP_001027070.1 Gene:CG33639 / 32803 FlyBaseID:FBgn0053639 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001019309.1 Gene:Gpr139 / 209776 MGIID:2685341 Length:345 Species:Mus musculus


Alignment Length:339 Identity:73/339 - (21%)
Similarity:135/339 - (39%) Gaps:91/339 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IICAMGIIGNVLNLVVLTR--RNMRGTAYIYMRAYSTAALLAIVFAIPFGIRMLVHKDRGQWEEF 131
            ::| :|:..|:|.:::|::  ...:.::|.|:.|.:.|.:| ::|.|.|...:|        |:|
Mouse    28 LLC-LGLPANILTVIILSQLVARRQKSSYNYLLALAAADIL-VLFFIVFVDFLL--------EDF 82

  Fly   132 GPAFYTAHLEL-------YLGNGCLGVGVMMLLVLTIERYVSVCHPGFARPVMGPPG-----VVV 184
               ..|..:.|       .|....:...:.:.:.||::||::||||.....|..|..     :.|
Mouse    83 ---ILTMQMPLIPDKIIEVLEFSSIHTSIWITVPLTVDRYIAVCHPLKYHTVSYPARTRKVILSV 144

  Fly   185 FLTCLATVIVYL--PSIFRGELIKCILGSSDVYVYLRRDNTIYQQTIFYRVYKIMLEVIFKLVPT 247
            ::||..|.|.|.  |:|:..:.|...:....|:::.            :.||         |||.
Mouse   145 YITCFLTSIPYYWWPNIWTEDYISTSMHHVLVWIHC------------FTVY---------LVPC 188

  Fly   248 LVIGGLNMRIMMVYRRTCERRRKMVLSRPHAQGHGHGHGHGHGHGHGHAHGHGYLKDDDPRKFAE 312
            .:...||..|:...||....|.:                       |::.|              
Mouse   189 SIFFILNSIIVYKLRRKSNFRLR-----------------------GYSTG-------------- 216

  Fly   313 ERRLFLLLGSTSILFLVCVSP--MAILHMTIASEVYPSFPFQVFRASANLLELINYSLTFYIYCL 375
             :...:|...||| |....:|  :.||:....:.:...:...:....||:|.|:|.::.|::||.
Mouse   217 -KTTAILFTITSI-FATLWAPRIIMILYHLYGAPIQNPWLVHIMLDVANMLALLNTAINFFLYCF 279

  Fly   376 FSEDFRNTLVRTIK 389
            .|:.||.....|:|
Mouse   280 ISKRFRTMAAATLK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33639NP_001027070.1 7tm_1 77..>278 CDD:278431 48/216 (22%)
Gpr139NP_001019309.1 7tm_1 36..277 CDD:278431 64/312 (21%)
7tm_4 65..298 CDD:304433 64/301 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848256
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.