DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Hesr and BHLHE41

DIOPT Version :9

Sequence 1:	NP_525094.1	Gene:	Hesr / 32800	FlyBaseID:	FBgn0030899	Length:	149	Species:	Drosophila melanogaster
Sequence 2:	NP_110389.1	Gene:	BHLHE41 / 79365	HGNCID:	16617	Length:	482	Species:	Homo sapiens

Alignment Length:	135	Identity:	44/135 - (32%)
Similarity:	63/135 - (46%)	Gaps:	29/135 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly    28 MMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLELAVHHLSKKNCPVATPTTAPTSG 92
            ::|:|||.|||.|:..:||||.|  ||...|:..::...||||.:.||.        ..||.|..
Human    51 LIEKKRRDRINECIAQLKDLLPE--HLKLTTLGHLEKAVVLELTLKHLK--------ALTALTEQ 105

  Fly    93 VYQ-------------SPI----DCYWSGFRECVLEVSQFL-QHNGYQPSFEFAKEL-DHLVAST 138
            .:|             |||    |.:.|||:.|..||.|:| :...:.|......:| :||.|..
Human   106 QHQKIIALQNGERSLKSPIQSDLDAFHSGFQTCAKEVLQYLSRFESWTPREPRCVQLINHLHAVA 170

  Fly   139 SKSKP 143
            ::..|
Human   171 TQFLP 175

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Hesr	NP_525094.1	HLH	21..77	CDD:238036	22/48 (46%)
Hesr	NP_525094.1	Hairy_orange	101..>116	CDD:295407	7/14 (50%)
BHLHE41	NP_110389.1	bHLH-O_DEC2	31..122	CDD:381593	26/80 (33%)
		Necessary for interaction with RXRA and repressor activity towards RXRA. /evidence=ECO:0000269\|PubMed:19786558	67..71		2/3 (67%)
		ORANGE	129..175	CDD:128787	14/45 (31%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	228..298
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	438..482
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165140898
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4304
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR10985
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	4	3.840