DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and Hes5

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_038966759.1 Gene:Hes5 / 79225 RGDID:621340 Length:196 Species:Rattus norvegicus


Alignment Length:179 Identity:45/179 - (25%)
Similarity:70/179 - (39%) Gaps:58/179 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KPMMERKRRSRINRCLDFIKDLLQE--VSHLDGETMAKMDMGDVLELAVHHLSKKN-----CP-V 82
            ||::|:.||.|||..::.:|.||::  ..|   :..:|::..|:||:||.:|....     |. |
  Rat    21 KPVVEKMRRDRINSSIEQLKLLLEQEFARH---QPNSKLEKADILEMAVSYLKHSKGELGACARV 82

  Fly    83 ATPT-TAPTSGVYQSPIDC----------------YWSGFRECVLEVSQFLQHNGYQPS-----F 125
            ..|| .|||:.....|:..                |..|:..|:.|..|||..:....:     :
  Rat    83 LLPTGVAPTARAPLMPLGLPTAFAAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLY 147

  Fly   126 EF----------------------AKELDHLVASTSKSKPN---LWRPW 149
            .|                      |:......||.|.|:.:   |||||
  Rat   148 HFQRPPAPAAPVKETPTPGAAPQPARSSTKAAASVSTSRQSACGLWRPW 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 19/52 (37%)
Hairy_orange 101..>116 CDD:295407 5/14 (36%)
Hes5XP_038966759.1 bHLH-O_HES5 18..74 CDD:381467 19/55 (35%)
ORANGE 116..158 CDD:128787 8/41 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334617
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.