DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and hes5.10

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001039178.1 Gene:hes5.10 / 734014 XenbaseID:XB-GENE-876529 Length:166 Species:Xenopus tropicalis


Alignment Length:170 Identity:39/170 - (22%)
Similarity:73/170 - (42%) Gaps:43/170 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PEEQKSHVGAKSRSHQYREVFKPMMERKRRSRINRCLDFIKDLLQ---EVSHLDGETMAKMDMGD 66
            |::.|:.:....::    ::.||::|:.||.|||..::.::.||:   :..|    ..:|::..|
 Frog     9 PDDTKAQLNDLKKN----KIRKPVIEKMRRDRINHSIEQLRILLERNFQTHH----PHSKLEKAD 65

  Fly    67 VLELAVHHL-SKKNCPVATPTTAPTSGVYQSPIDCYWSGFRECVLEVSQFL--QHNG-------- 120
            :||:||.:| .:|...:......|     ::..|.|:.|:..|:.|...||  |.||        
 Frog    66 ILEMAVSYLQQQKKHQMNRSHLLP-----ENVQDSYYQGYYMCLKETVGFLHTQENGHIQEENKN 125

  Fly   121 -----------YQPSFEFAKELDHLVASTSKSKPNLWRPW 149
                       ||..::     ..:....|.....:||||
 Frog   126 LTWNDSCLPAPYQSLYQ-----QRVSLQVSPGSMKIWRPW 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 18/59 (31%)
Hairy_orange 101..>116 CDD:295407 4/14 (29%)
hes5.10NP_001039178.1 bHLH-O_HES5 23..81 CDD:381467 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.