DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and hes7.1

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001039166.1 Gene:hes7.1 / 733997 XenbaseID:XB-GENE-876465 Length:178 Species:Xenopus tropicalis


Alignment Length:178 Identity:39/178 - (21%)
Similarity:62/178 - (34%) Gaps:62/178 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YREVFKPMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLELAVHHLSKKNCPVATP 85
            :|::.||::||:||.|||..|:.::..|.:....:.....|::..::||..|..|....      
 Frog    13 HRKLLKPLVERRRRERINNSLEKLRIFLSQALKSEKLKNPKVEKAEILECTVQFLQSSK------ 71

  Fly    86 TTAPTSGVYQSPIDC----YWSGFRECV--------------LEVSQFLQH--NGYQ-------- 122
             ..|..|      |.    |.|||:.|:              :....||.|  :.|:        
 Frog    72 -LVPQDG------DVGNKGYQSGFQHCLETALHFMNSKPDLNVATKDFLSHQLSSYKPPAEAWSP 129

  Fly   123 -------PSFEFAKELDHLVASTSKSKP--------------NLWRPW 149
                   ||..:.....||.::|....|              ..||||
 Frog   130 TDTPKPTPSIGYQDSAPHLSSNTISVSPTKTLVDGQFSPQTFQTWRPW 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 17/55 (31%)
Hairy_orange 101..>116 CDD:295407 5/28 (18%)
hes7.1NP_001039166.1 bHLH-O_HES7 14..74 CDD:381468 17/66 (26%)
Hairy_orange 84..121 CDD:369405 8/36 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..147 2/24 (8%)
WRPW motif. /evidence=ECO:0000255 174..177 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.