DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and hes5.1

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001037880.1 Gene:hes5.1 / 733463 XenbaseID:XB-GENE-481135 Length:154 Species:Xenopus tropicalis


Alignment Length:146 Identity:45/146 - (30%)
Similarity:66/146 - (45%) Gaps:34/146 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KPMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLELAVHHLSKKNCPVATPTTAPT 90
            ||::|:.||.|||..::.:|.||::..|.. |...|::..|:||:||.:|.::..  .:|..|..
 Frog    21 KPIVEKMRRDRINNSIEQLKALLEKEFHKQ-EPNVKLEKADILEMAVSYLQQQKS--QSPNLAKL 82

  Fly    91 SGVYQSPIDCYWSGFRECVLEVSQFLQHNGYQPSFEF-AKELDHL-------------VASTSKS 141
            ...|:       .||..|:.|..|||.:  |..|.|. .|.|.||             :.|.|.|
 Frog    83 EQDYK-------QGFSSCLREAVQFLCY--YPESGETQMKLLKHLQAPQKLSVAPLTYIPSVSDS 138

  Fly   142 K--------PNLWRPW 149
            |        ..:||||
 Frog   139 KQAALASNPSKIWRPW 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 20/50 (40%)
Hairy_orange 101..>116 CDD:295407 5/14 (36%)
hes5.1NP_001037880.1 HLH 14..75 CDD:238036 20/56 (36%)
Hairy_orange 84..121 CDD:295407 15/45 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.