DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and Hes3

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_073178.1 Gene:Hes3 / 64628 RGDID:621339 Length:175 Species:Rattus norvegicus


Alignment Length:136 Identity:38/136 - (27%)
Similarity:59/136 - (43%) Gaps:28/136 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 MERKRRSRINRCLDFIKDLLQEVSHLDGE-TMAKMDMGDVLELAVHHL-SKKNCPVATPTTAPTS 91
            ||:|||:|||..|:.::.||:.  |...: ...|::..|:|||:|.:: |.:|         ...
  Rat     1 MEKKRRARINLSLEQLRSLLER--HYSHQIRKRKLEKADILELSVKYVRSLQN---------SLQ 54

  Fly    92 GVYQSP--IDCYWSGFRECVLEVSQFLQHNGYQPSFEFAKELDHLVASTSKSK------------ 142
            |::..|  :| |.||||..:...||.|:.............|.....||:.|.            
  Rat    55 GLWLVPSGVD-YPSGFRGGLPGSSQRLRPGEDDSGLRCPLLLQRRAGSTTDSANPQTASVLSPCL 118

  Fly   143 PNLWRP 148
            |.:|.|
  Rat   119 PAIWAP 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 18/49 (37%)
Hairy_orange 101..>116 CDD:295407 7/14 (50%)
Hes3NP_073178.1 bHLH-O_HES3 1..55 CDD:381503 20/64 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..175 1/1 (100%)
WRPW motif 172..175
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334561
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.