DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and hey2

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_571697.2 Gene:hey2 / 58146 ZFINID:ZDB-GENE-000526-1 Length:324 Species:Danio rerio


Alignment Length:100 Identity:27/100 - (27%)
Similarity:48/100 - (48%) Gaps:16/100 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 REVFKPMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLELAVHHLSKKNCPVATPT 86
            |:..:.::|::||.|||..|..::.|:.......|.  ||::..::|::.|.||.....      
Zfish    49 RKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGS--AKLEKAEILQMTVDHLKMLQA------ 105

  Fly    87 TAPTSG-----VYQSPIDCYWSGFRECVLEVSQFL 116
               |.|     .:...:|....|||||:.||:::|
Zfish   106 ---TGGKGYFDAHSLAMDFLSIGFRECLTEVARYL 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 16/54 (30%)
Hairy_orange 101..>116 CDD:295407 7/14 (50%)
hey2NP_571697.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
HLH 49..105 CDD:238036 16/57 (28%)
Hairy_orange 125..162 CDD:284859 7/12 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..324
YRPW motif 314..317
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573721
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.