DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and HES4

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001135939.1 Gene:HES4 / 57801 HGNCID:24149 Length:247 Species:Homo sapiens


Alignment Length:122 Identity:38/122 - (31%)
Similarity:64/122 - (52%) Gaps:10/122 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KPMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLELAVHHL-SKKNCPVATPTTAP 89
            ||:||::||:|||..|..:|.|:.:....:....:|::..|:||:.|.|| |.:...|....:|.
Human    65 KPVMEKRRRARINESLAQLKTLILDALRKESSRHSKLEKADILEMTVRHLRSLRRVQVTAALSAD 129

  Fly    90 TS--GVYQSPIDCYWSGFRECVLEVSQFLQHNGYQPSFEFAKELDHLVASTSKSKPN 144
            .:  |.|:       :||.||:.||::||......|:...::.|.||.|...:..|:
Human   130 PAVLGKYR-------AGFHECLAEVNRFLAGCEGVPADVRSRLLGHLAACLRQLGPS 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 19/51 (37%)
Hairy_orange 101..>116 CDD:295407 6/14 (43%)
HES4NP_001135939.1 HLH 62..119 CDD:238036 20/53 (38%)
Hairy_orange 136..174 CDD:284859 14/44 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140962
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.