DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and her8.2

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001159638.1 Gene:her8.2 / 565269 ZFINID:ZDB-GENE-060815-4 Length:211 Species:Danio rerio


Alignment Length:152 Identity:46/152 - (30%)
Similarity:77/152 - (50%) Gaps:20/152 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMARPEEQKS---HVGAKSRSHQYREVFKPMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKM 62
            |.|...:|.|   |:.:|    :.|::.||::|||||.|||.|||.:::.:..|...|   .:|:
Zfish     3 MTATKLQQNSCQLHISSK----EERKLRKPLIERKRRERINLCLDQLRETVVAVFKPD---QSKL 60

  Fly    63 DMGDVLELAVHHLSK-KNCPVATPTTAPTSGVYQSPIDCYWSGFRECVLEVSQFLQHNGYQPSFE 126
            :..|:||:.|.||.. ::..|:.|..  .:|..|.    |.:|:.:|:.||...|....:.....
Zfish    61 EKADILEMTVKHLQNIQSSRVSDPVL--NTGARQR----YSTGYIQCMQEVHNLLHSCDWMDKTL 119

  Fly   127 FAKELDHLVAS---TSKSKPNL 145
            .::.|:||..|   ::|..|.|
Zfish   120 GSRLLNHLFKSLPLSAKDCPRL 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 23/55 (42%)
Hairy_orange 101..>116 CDD:295407 5/14 (36%)
her8.2NP_001159638.1 HLH 20..77 CDD:238036 24/63 (38%)
Hairy_orange 94..132 CDD:284859 10/37 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573656
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.