DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and bhlhe41

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001034196.1 Gene:bhlhe41 / 563771 ZFINID:ZDB-GENE-050419-146 Length:421 Species:Danio rerio


Alignment Length:163 Identity:46/163 - (28%)
Similarity:70/163 - (42%) Gaps:36/163 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EQKSHVGAKSRSHQYREVFKP-------MMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDM 64
            |..|....||:....||..|.       ::|:|||.|||.|:..:||||.|  ||...|:..::.
Zfish    23 EYSSLYMCKSKRGMKREEGKDAYKLPHRLIEKKRRDRINECIGQLKDLLPE--HLKLTTLGHLEK 85

  Fly    65 GDVLELAVHHLSKKNCPVATPTTAPTSGVY-----------------QSPIDCYWSGFRECVLEV 112
            ..||||.:.||:        ..||.|...:                 |:.:|.:.|||:.|..||
Zfish    86 AVVLELTLKHLN--------ALTAVTEQQHQKIIALQNGERSLKSSLQADLDAFHSGFQACAKEV 142

  Fly   113 SQFLQ--HNGYQPSFEFAKELDHLVASTSKSKP 143
            .|:|.  .|.........:.::||...:::.:|
Zfish   143 LQYLNKVENWTAREQRCTRLINHLHKVSAQFQP 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 25/62 (40%)
Hairy_orange 101..>116 CDD:295407 7/14 (50%)
bhlhe41NP_001034196.1 HLH 46..99 CDD:238036 22/62 (35%)
Hairy_orange 131..171 CDD:284859 11/39 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573705
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.