DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and HES6

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_061115.2 Gene:HES6 / 55502 HGNCID:18254 Length:224 Species:Homo sapiens


Alignment Length:116 Identity:32/116 - (27%)
Similarity:55/116 - (47%) Gaps:9/116 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 REVFKPMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLELAVHHLSKKNCPVATPT 86
            |:..||::|:|||:|||..|..::.||     ...|..||::..:||||.|..:.    .|....
Human    26 RKARKPLVEKKRRARINESLQELRLLL-----AGAEVQAKLENAEVLELTVRRVQ----GVLRGR 81

  Fly    87 TAPTSGVYQSPIDCYWSGFRECVLEVSQFLQHNGYQPSFEFAKELDHLVAS 137
            ......:.....:.:.:|:.:|:.||..|:.......:...|:.|:||:.|
Human    82 AREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDATVAAELLNHLLES 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 21/54 (39%)
Hairy_orange 101..>116 CDD:295407 4/14 (29%)
HES6NP_061115.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 1/4 (25%)
HLH 23..75 CDD:238036 21/53 (40%)
Hairy_orange 96..134 CDD:311465 10/37 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..205
WRPW motif 221..224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140865
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.700

Return to query results.
Submit another query.