DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and HES2

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_061962.2 Gene:HES2 / 54626 HGNCID:16005 Length:173 Species:Homo sapiens


Alignment Length:171 Identity:42/171 - (24%)
Similarity:71/171 - (41%) Gaps:50/171 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QYREVFKPMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLELAVHHLSKKNCPVAT 84
            :.|:..||::|::||:|||:.|..:|.|:..:...:....:|::..||||:.|..|  :..|.::
Human    12 ELRKSLKPLLEKRRRARINQSLSQLKGLILPLLGRENSNCSKLEKADVLEMTVRFL--QELPASS 74

  Fly    85 -PTTAPTSGVYQSPIDCYWSGFRECVLEVSQFLQH-NGYQPSFEFAKELDHLVASTSKSK----- 142
             ||.||.      |.|.|..|:..||..:::.|.. ...:|:.. |:.|:||....:.:.     
Human    75 WPTAAPL------PCDSYREGYSACVARLARVLPACRVLEPAVS-ARLLEHLWRRAASATLDGGR 132

  Fly   143 ----------------------------------PNLWRPW 149
                                              |.|||||
Human   133 AGDSSGPSAPAPAPASAPEPASAPVPSPPSPPCGPGLWRPW 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 19/55 (35%)
Hairy_orange 101..>116 CDD:295407 4/14 (29%)
HES2NP_061962.2 HLH 12..70 CDD:238036 19/59 (32%)
ORANGE 84..127 CDD:128787 11/43 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..173 4/44 (9%)
WRPW motif 170..173 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140930
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.