DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and hes1

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001011194.1 Gene:hes1 / 496617 XenbaseID:XB-GENE-487995 Length:267 Species:Xenopus tropicalis


Alignment Length:116 Identity:37/116 - (31%)
Similarity:64/116 - (55%) Gaps:11/116 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMARPEEQKSHVGAKSRSHQYREVFKPMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMG 65
            |...|::.|:       :.::|:..||:||::||:|||..|..:|.|:.:....|....:|::..
 Frog    21 MSNTPDKPKT-------ASEHRKSSKPIMEKRRRARINESLGQLKTLILDALKKDSSRHSKLEKA 78

  Fly    66 DVLELAVHHLSKKNCPVATPTTAPTSGVYQSPIDCYWSGFRECVLEVSQFL 116
            |:||:.|.||  :|......|.|.::.  .|.:..|.:||.||:.||::||
 Frog    79 DILEMTVKHL--RNLQRVQMTAALSTD--PSVLGKYRAGFSECMNEVTRFL 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 21/55 (38%)
Hairy_orange 101..>116 CDD:295407 7/14 (50%)
hes1NP_001011194.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 8/30 (27%)
bHLH-O_HES1_4 33..95 CDD:381465 22/63 (35%)
Hairy_orange 110..148 CDD:369405 9/16 (56%)
WRPW motif. /evidence=ECO:0000255 264..267
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.