DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and cwo

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_524775.1 Gene:cwo / 44669 FlyBaseID:FBgn0259938 Length:698 Species:Drosophila melanogaster


Alignment Length:106 Identity:23/106 - (21%)
Similarity:50/106 - (47%) Gaps:18/106 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GAKSRSHQYREVFKPMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLELAVHHLS- 76
            |.::::.:...:...::|::||.|:|.||..:..|:.......|.  .:::..:::|:|:.||. 
  Fly    54 GRRNKTSRQDPLSHRIIEKRRRDRMNSCLADLSRLIPPQYQRKGR--GRIEKTEIIEMAIRHLKH 116

  Fly    77 -KKNCPVATPTTAPTSGVYQSPIDCYWSGFRECVLEVSQFL 116
             :..|              |.....|.||:.:|:.|.::||
  Fly   117 LQSEC--------------QQKESDYRSGYMDCMKEAAKFL 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 13/57 (23%)
Hairy_orange 101..>116 CDD:295407 5/14 (36%)
cwoNP_524775.1 HLH 66..118 CDD:306515 13/53 (25%)
ORANGE 126..168 CDD:128787 7/18 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438370
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.