DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and E(spl)m7-HLH

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_536753.1 Gene:E(spl)m7-HLH / 43160 FlyBaseID:FBgn0002633 Length:186 Species:Drosophila melanogaster


Alignment Length:196 Identity:52/196 - (26%)
Similarity:80/196 - (40%) Gaps:79/196 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SRSHQYREVFKPMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLELAVHHL----- 75
            |:::|||:|.||::|||||:|||:|||.:|||:.|.....|:  ||.:..|:||:.|.||     
  Fly     8 SKTYQYRKVMKPLLERKRRARINKCLDELKDLMAECVAQTGD--AKFEKADILEVTVQHLRKLKE 70

  Fly    76 SKKNCPVATPTTAPTSGVYQSPIDCYWSGFRECVLEVSQ---------------FLQHNGY---- 121
            |||:.|.             :|...:.:|:.....|||:               .:.|.|.    
  Fly    71 SKKHVPA-------------NPEQSFRAGYIRAANEVSRALASLPRVDVAFGTTLMTHLGMRLNQ 122

  Fly   122 ------QP--------------------------------SFEFAKELDHLVASTSKSKPNLWRP 148
                  ||                                |..:|.:.:.|:..:|..:  :|||
  Fly   123 LEQPMEQPQAVNTPLSIVCGSSSSSSTYSSASSCSSISPVSSGYASDNESLLQISSPGQ--VWRP 185

  Fly   149 W 149
            |
  Fly   186 W 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 29/60 (48%)
Hairy_orange 101..>116 CDD:295407 4/29 (14%)
E(spl)m7-HLHNP_536753.1 HLH 13..73 CDD:238036 30/61 (49%)
ORANGE 81..125 CDD:128787 6/43 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469375
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
54.840

Return to query results.
Submit another query.