DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and E(spl)m3-HLH

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster


Alignment Length:224 Identity:54/224 - (24%)
Similarity:87/224 - (38%) Gaps:95/224 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SRSHQYREVFKPMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLELAVHHLSKKN- 79
            |:::|||:|.||::|||||:|||:|||.:|||:.|....:||.:.:::..|:|||.|.|:.|.. 
  Fly     6 SKTYQYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQ 70

  Fly    80 ----------CPVATPTTAPTSGVYQSPIDCYWSGFRECVLEVSQFL------------------ 116
                      ..|.:|.|:.::    :.::.:.||:.....:::|.|                  
  Fly    71 RGGLSLQGVVAGVGSPPTSTST----AHVESFRSGYVHAADQITQVLLQTQQTDEIGRKIMKFLS 131

  Fly   117 ------------------QH-----------------NGYQPS--------FEFAKELDHLVAST 138
                              ||                 .||.|:        ..|....|.|:..|
  Fly   132 TRLIELQTQLLQQQQQQQQHQQQQIPQSSGRLAFPLLGGYGPAAAAAAISYSSFLTSKDELIDVT 196

  Fly   139 S------------------KSKPNLWRPW 149
            |                  .|:| :||||
  Fly   197 SVDGNALSETASVSSQESGASEP-VWRPW 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 28/55 (51%)
Hairy_orange 101..>116 CDD:295407 3/14 (21%)
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 29/58 (50%)
ORANGE 96..136 CDD:128787 4/39 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469370
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
54.840

Return to query results.
Submit another query.