Sequence 1: | NP_525094.1 | Gene: | Hesr / 32800 | FlyBaseID: | FBgn0030899 | Length: | 149 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_524509.2 | Gene: | E(spl)m3-HLH / 43156 | FlyBaseID: | FBgn0002609 | Length: | 224 | Species: | Drosophila melanogaster |
Alignment Length: | 224 | Identity: | 54/224 - (24%) |
---|---|---|---|
Similarity: | 87/224 - (38%) | Gaps: | 95/224 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 SRSHQYREVFKPMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLELAVHHLSKKN- 79
Fly 80 ----------CPVATPTTAPTSGVYQSPIDCYWSGFRECVLEVSQFL------------------ 116
Fly 117 ------------------QH-----------------NGYQPS--------FEFAKELDHLVAST 138
Fly 139 S------------------KSKPNLWRPW 149 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hesr | NP_525094.1 | HLH | 21..77 | CDD:238036 | 28/55 (51%) |
Hairy_orange | 101..>116 | CDD:295407 | 3/14 (21%) | ||
E(spl)m3-HLH | NP_524509.2 | HLH | 11..70 | CDD:238036 | 29/58 (50%) |
ORANGE | 96..136 | CDD:128787 | 4/39 (10%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45469370 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR10985 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X1011 | |
5 | 4.840 |