DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and her12

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_991182.1 Gene:her12 / 402914 ZFINID:ZDB-GENE-040824-5 Length:155 Species:Danio rerio


Alignment Length:149 Identity:41/149 - (27%)
Similarity:61/149 - (40%) Gaps:44/149 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KPMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLELAVHHLSKKNCPVATPTTAPT 90
            ||::|:.||.|||.|:|.:|.||::..| ..:...|::..|:||:.|..|.::           .
Zfish    26 KPIVEKMRRDRINTCIDQLKSLLEKEFH-SHDPSTKLEKADILEMTVSFLKQQ-----------I 78

  Fly    91 SGVYQSPIDCYWSGFRECVLEVSQFLQ-HNGYQPSFEFAKELDHL------------VASTSKSK 142
            ....|.|...:..|:..|..|...||. |:.       |.||.||            ..:|:.||
Zfish    79 KQQQQIPQRDFNEGYSHCWRESVHFLSLHSN-------AGELQHLHSGPKTNSTMGSTPATACSK 136

  Fly   143 PN------------LWRPW 149
            .|            :||||
Zfish   137 LNTAALQHPDSVRAVWRPW 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 20/50 (40%)
Hairy_orange 101..>116 CDD:295407 3/14 (21%)
her12NP_991182.1 HLH 19..74 CDD:238036 19/48 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573691
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.