DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and h

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001014577.1 Gene:h / 38995 FlyBaseID:FBgn0001168 Length:337 Species:Drosophila melanogaster


Alignment Length:109 Identity:36/109 - (33%)
Similarity:61/109 - (55%) Gaps:8/109 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KPMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLELAVHHLSKKNCPVATPTTAPT 90
            ||:||::||:|||.||:.:|.|:.:.:..|....:|::..|:||..|.||.:.....|....|..
  Fly    36 KPIMEKRRRARINNCLNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQAAMQQAAD 100

  Fly    91 SGVYQSPIDCYWSGFRECVLEVSQFLQHNGYQPSFEFAKELDHL 134
            ..:    ::.:.:||.:||.|||:|   .|.:|: :..:.|.||
  Fly   101 PKI----VNKFKAGFADCVNEVSRF---PGIEPA-QRRRLLQHL 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 21/50 (42%)
Hairy_orange 101..>116 CDD:295407 7/14 (50%)
hNP_001014577.1 HLH 29..88 CDD:238036 21/51 (41%)
ORANGE 106..141 CDD:128787 13/35 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438358
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.