DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and Hey

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster


Alignment Length:144 Identity:38/144 - (26%)
Similarity:60/144 - (41%) Gaps:29/144 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 REVFKPMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLELAVHHLSKKNCPVATPT 86
            |:..:.::|:|||.|||..|..:|.|:.......|.  ||::..::|:|.|.||...........
  Fly   101 RKKRRGVIEKKRRDRINSSLTELKRLVPSAYEKQGS--AKLEKAEILQLTVEHLKSLQSKTLDSL 163

  Fly    87 TAPTSGVYQSPIDCYWSGFRECVLEVSQFL-----------------QHNGYQPSFEFAKELDHL 134
            :.....|   .:|.:..|||||..||:::|                 .|..|   |...:||   
  Fly   164 SYDPQRV---AMDYHIIGFRECAAEVARYLVTIEGMDIQDPLRLRLMSHLQY---FVQQREL--- 219

  Fly   135 VASTSKSKPNLWRP 148
             ::.|.:.|..|.|
  Fly   220 -SAKSCASPGGWSP 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 19/54 (35%)
Hairy_orange 101..>116 CDD:295407 7/14 (50%)
HeyNP_523657.1 HLH 100..156 CDD:238036 19/56 (34%)
ORANGE 172..218 CDD:128787 12/48 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.