DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and bhlhe40

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_997844.2 Gene:bhlhe40 / 324413 ZFINID:ZDB-GENE-030131-3133 Length:403 Species:Danio rerio


Alignment Length:164 Identity:48/164 - (29%)
Similarity:70/164 - (42%) Gaps:31/164 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KSHVGAKSRSHQYREVFK---PMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLEL 70
            |...|.| ||...::.:|   .::|:|||.|||.|:..:||||.|  ||...|:..::...||||
Zfish    35 KPRRGMK-RSEDSKDTYKLPHRLIEKKRRDRINECIAQLKDLLPE--HLKLTTLGHLEKAVVLEL 96

  Fly    71 AVHHLSKKN----------------CPVATPTTAPTSGVYQSPIDCYWSGFRECVLEVSQFLQHN 119
            .:.|:...|                ..:......|:    ::..:.:.|||..|..||.|||.:.
Zfish    97 TLKHVKALNNLLEQQQQKIISLQNGLQIGEQGNGPS----ENSEEMFRSGFHLCAKEVLQFLANQ 157

  Fly   120 GYQPSFEFAKELDHL--VAS---TSKSKPNLWRP 148
            ........|..::||  |||   .|...|.|..|
Zfish   158 ETMRDLTTAHIIEHLQKVASELIQSPPSPRLDEP 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 22/58 (38%)
Hairy_orange 101..>116 CDD:295407 7/14 (50%)
bhlhe40NP_997844.2 HLH 51..109 CDD:238036 23/59 (39%)
Hairy_orange 139..177 CDD:284859 13/37 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573801
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.