DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and her6

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_571154.2 Gene:her6 / 30288 ZFINID:ZDB-GENE-980526-144 Length:270 Species:Danio rerio


Alignment Length:120 Identity:39/120 - (32%)
Similarity:64/120 - (53%) Gaps:19/120 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMARPEEQKSHVGAKSRSHQYREVFKPMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMG 65
            |...|::.|:       :.::|:..||:||::||:|||..|..:|.|:.:....|....:|::..
Zfish    21 MNTTPDKPKT-------ASEHRKSSKPIMEKRRRARINESLGQLKTLILDALKKDSSRHSKLEKA 78

  Fly    66 DVLELAVHHLSKKNCPVATPTTA----PTSGVYQSPIDCYWSGFRECVLEVSQFL 116
            |:||:.|.||  :|...|..|.|    ||      .:..|.:||.||:.||::||
Zfish    79 DILEMTVKHL--RNMQRAQMTAALNTDPT------VLGKYRAGFSECMNEVTRFL 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 21/55 (38%)
Hairy_orange 101..>116 CDD:295407 7/14 (50%)
her6NP_571154.2 HLH 32..95 CDD:238036 22/64 (34%)
Hairy_orange 110..148 CDD:284859 9/16 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573737
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.