DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Hesr and HEY2

DIOPT Version :9

Sequence 1:	NP_525094.1	Gene:	Hesr / 32800	FlyBaseID:	FBgn0030899	Length:	149	Species:	Drosophila melanogaster
Sequence 2:	NP_036391.1	Gene:	HEY2 / 23493	HGNCID:	4881	Length:	337	Species:	Homo sapiens

Alignment Length:	100	Identity:	27/100 - (27%)
Similarity:	48/100 - (48%)	Gaps:	16/100 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly    22 REVFKPMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLELAVHHLSKKNCPVATPT 86
            |:..:.::|::||.|||..|..::.|:.......|.  ||::..::|::.|.||.....
Human    49 RKKRRGIIEKRRRDRINNSLSELRRLVPTAFEKQGS--AKLEKAEILQMTVDHLKMLQA------ 105

  Fly    87 TAPTSG-----VYQSPIDCYWSGFRECVLEVSQFL 116
               |.|     .:...:|....|||||:.||:::|
Human   106 ---TGGKGYFDAHALAMDFMSIGFRECLTEVARYL 137

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Hesr	NP_525094.1	HLH	21..77	CDD:238036	16/54 (30%)
Hesr	NP_525094.1	Hairy_orange	101..>116	CDD:295407	7/14 (50%)
HEY2	NP_036391.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..52		1/2 (50%)
		bHLH-O_HEY2	40..121	CDD:381490	18/82 (22%)
		Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250	47..116		18/77 (23%)
		ORANGE	119..165	CDD:128787	8/18 (44%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	307..337
		YRPW motif	327..330
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165140906
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4304
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	3	2.740