DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and HEY1

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001035798.1 Gene:HEY1 / 23462 HGNCID:4880 Length:308 Species:Homo sapiens


Alignment Length:96 Identity:28/96 - (29%)
Similarity:51/96 - (53%) Gaps:16/96 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 MMERKRRSRINRCLDFIKDLLQEVSHLDGETM----AKMDMGDVLELAVHHLSKKNCPVATPTTA 88
            ::|::||.|||..|..::.|:.  |..:.:.|    ||::..::|::.|.||...:       ||
Human    56 IIEKRRRDRINNSLSELRRLVP--SAFEKQVMEQGSAKLEKAEILQMTVDHLKMLH-------TA 111

  Fly    89 PTSGVYQS---PIDCYWSGFRECVLEVSQFL 116
            ...|.:.:   .:|....|||||:.||:::|
Human   112 GGKGYFDAHALAMDYRSLGFRECLAEVARYL 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 16/52 (31%)
Hairy_orange 101..>116 CDD:295407 7/14 (50%)
HEY1NP_001035798.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52
bHLH_SF 41..126 CDD:381792 19/78 (24%)
ORANGE 124..170 CDD:128787 9/19 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..238
YRPW motif 298..301
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140882
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.