DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Hesr and Bhlhe40

DIOPT Version :9

Sequence 1:	NP_525094.1	Gene:	Hesr / 32800	FlyBaseID:	FBgn0030899	Length:	149	Species:	Drosophila melanogaster
Sequence 2:	NP_035628.1	Gene:	Bhlhe40 / 20893	MGIID:	1097714	Length:	411	Species:	Mus musculus

Alignment Length:	141	Identity:	42/141 - (29%)
Similarity:	66/141 - (46%)	Gaps:	18/141 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly     9 KSHVGAKSRSHQYREVFK---PMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLEL 70
            ||..|.| ||...:|.:|   .::|:|||.|||.|:..:||||.|  ||...|:..::...||||
Mouse    38 KSRRGIK-RSEDSKETYKLPHRLIEKKRRDRINECIAQLKDLLPE--HLKLTTLGHLEKAVVLEL 99

  Fly    71 AVHHLSKKNCPV---ATPTTAPTSGVYQSPI---------DCYWSGFRECVLEVSQFLQHNGYQP 123
            .:.|:......:   .....|..||:....:         :.:.|||:.|..||.|:|..:....
Mouse   100 TLKHVKALTNLIDQQQQKIIALQSGLQAGDLSGRNLEAGQEMFCSGFQTCAREVLQYLAKHENTR 164

  Fly   124 SFEFAKELDHL 134
            ..:.::.:.||
Mouse   165 DLKSSQLVTHL 175

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Hesr	NP_525094.1	HLH	21..77	CDD:238036	23/58 (40%)
Hesr	NP_525094.1	Hairy_orange	101..>116	CDD:295407	7/14 (50%)
Bhlhe40	NP_035628.1	Essential for interaction with ARNTL/BMAL1, E-box binding and repressor activity against the CLOCK-ARNTL/BMAL1 heterodimer. /evidence=ECO:0000250	1..139		32/103 (31%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..20
		bHLH-O_DEC1	40..129	CDD:381592	30/91 (33%)
		Necessary for interaction with RXRA and repressor activity against RXRA. /evidence=ECO:0000250	75..79		2/3 (67%)
		ORANGE	140..184	CDD:128787	10/36 (28%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	207..294
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167830901
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4304
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR10985
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	4	3.840