DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and Bhlhe40

DIOPT Version :10

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_035628.1 Gene:Bhlhe40 / 20893 MGIID:1097714 Length:411 Species:Mus musculus


Alignment Length:141 Identity:42/141 - (29%)
Similarity:66/141 - (46%) Gaps:18/141 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KSHVGAKSRSHQYREVFK---PMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLEL 70
            ||..|.| ||...:|.:|   .::|:|||.|||.|:..:||||.|  ||...|:..::...||||
Mouse    38 KSRRGIK-RSEDSKETYKLPHRLIEKKRRDRINECIAQLKDLLPE--HLKLTTLGHLEKAVVLEL 99

  Fly    71 AVHHLSKKNCPV---ATPTTAPTSGVYQSPI---------DCYWSGFRECVLEVSQFLQHNGYQP 123
            .:.|:......:   .....|..||:....:         :.:.|||:.|..||.|:|..:....
Mouse   100 TLKHVKALTNLIDQQQQKIIALQSGLQAGDLSGRNLEAGQEMFCSGFQTCAREVLQYLAKHENTR 164

  Fly   124 SFEFAKELDHL 134
            ..:.::.:.||
Mouse   165 DLKSSQLVTHL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 bHLH_SF 16..77 CDD:469605 25/63 (40%)
Hairy_orange 101..>116 CDD:470640 7/14 (50%)
Bhlhe40NP_035628.1 Essential for interaction with BMAL1, E-box binding and repressor activity against the CLOCK-BMAL1 heterodimer. /evidence=ECO:0000250 1..139 32/103 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
bHLH-O_DEC1 40..129 CDD:381592 30/91 (33%)
Necessary for interaction with RXRA and repressor activity against RXRA. /evidence=ECO:0000250 75..79 2/3 (67%)
ORANGE 140..184 CDD:128787 10/36 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..294
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.