DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and Hes5

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_006538625.3 Gene:Hes5 / 15208 MGIID:104876 Length:415 Species:Mus musculus


Alignment Length:180 Identity:41/180 - (22%)
Similarity:67/180 - (37%) Gaps:59/180 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KPMMERKRRSRINRCLDFIKDLLQE--VSHLDGETMAKMDMGDVLELAVHHLSKKN-----C--- 80
            ||::|:.||.|||..::.:|.||::  ..|   :..:|::..|:||:||.:|....     |   
Mouse   239 KPVVEKMRRDRINSSIEQLKLLLEQEFARH---QPNSKLEKADILEMAVSYLKHSKGEPGACARL 300

  Fly    81 ---------------PVATPTTAPTSGVYQSPIDCYWSGFRECVLEVSQFLQHNGY--------- 121
                           |:..||....:...:|....|..|:..|:.|..|||..:..         
Mouse   301 LLPADVAPTARAPLMPLRLPTAFAAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLY 365

  Fly   122 ----------------------QPSFEFAKELDHLVASTSKSKPNLWRPW 149
                                  ||:...||.....|:::.:....|||||
Mouse   366 HFQRPPAPAAPAKEPPAPGAAPQPARSSAKAAAAAVSTSRQPACGLWRPW 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 19/52 (37%)
Hairy_orange 101..>116 CDD:295407 5/14 (36%)
Hes5XP_006538625.3 bHLH-O_HES5 236..292 CDD:381467 19/55 (35%)
ORANGE 334..369 CDD:128787 7/34 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830909
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1011
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.