DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and Bhlhe41

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_038964817.1 Gene:Bhlhe41 / 117095 RGDID:70900 Length:410 Species:Rattus norvegicus


Alignment Length:106 Identity:37/106 - (34%)
Similarity:51/106 - (48%) Gaps:27/106 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 MMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLELAVHHLSKKNCPVATPTTAPTSG 92
            ::|:|||.|||.|:..:||||.|  ||...|:..::...||||.:.||.        ..||.|..
  Rat    51 LIEKKRRDRINECIAQLKDLLPE--HLKLTTLGHLEKAVVLELTLKHLK--------ALTALTEQ 105

  Fly    93 VYQ-------------SPI----DCYWSGFRECVLEVSQFL 116
            .:|             ||:    |.:.|||:.|..||.|:|
  Rat   106 QHQKIIALQNGERSLKSPVQADLDAFHSGFQTCAKEVLQYL 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 22/48 (46%)
Hairy_orange 101..>116 CDD:295407 7/14 (50%)
Bhlhe41XP_038964817.1 bHLH-O_DEC2 31..122 CDD:381593 26/80 (33%)
ORANGE 129..175 CDD:128787 9/18 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334569
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.