DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and hes7.2

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_002942675.1 Gene:hes7.2 / 100496131 XenbaseID:XB-GENE-486482 Length:243 Species:Xenopus tropicalis


Alignment Length:108 Identity:34/108 - (31%)
Similarity:58/108 - (53%) Gaps:12/108 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GAKSR-SHQYRE---VFKPMMERKRRSRINRCLDFIKDLLQEVSHLDGETMAKMDMGDVLELAVH 73
            |.:.| |:..||   :.||::|::||.|||:.|:.::.||.|.:|.:.....|.:..|:|:..||
 Frog    12 GCRMRNSYPNREDKRLMKPVIEKRRRDRINQSLEHLRTLLLEATHDETLKNPKAEKADILKKTVH 76

  Fly    74 HLSKKNCPVATPTTAPTSGVYQSPIDCYWSGFRECVLEVSQFL 116
            .|...:.||      |:.|  :..:..:..||||.:.:.:.||
 Frog    77 FLKMCHNPV------PSDG--KKLLSGFKGGFREGLNQATSFL 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 21/58 (36%)
Hairy_orange 101..>116 CDD:295407 4/14 (29%)
hes7.2XP_002942675.1 HLH 22..80 CDD:238036 21/57 (37%)
ORANGE 94..138 CDD:128787 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.