DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hesr and hes5.5

DIOPT Version :9

Sequence 1:NP_525094.1 Gene:Hesr / 32800 FlyBaseID:FBgn0030899 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001165751.1 Gene:hes5.5 / 100337645 XenbaseID:XB-GENE-6492485 Length:158 Species:Xenopus tropicalis


Alignment Length:150 Identity:35/150 - (23%)
Similarity:66/150 - (44%) Gaps:36/150 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 REVFKPMMERKRRSRINRCLDFIKDLLQ---EVSHLDGETMAKMDMGDVLELAVHHLSKKNCPVA 83
            |::.||::|:.||.|||..::.::.||:   :..||.    :|.:..|:||:||..:.::   :|
 Frog    22 RKMRKPVVEKMRRDRINSSIEQLRMLLEKEFDSHHLP----SKPEKADILEVAVSFMQQQ---MA 79

  Fly    84 TPTTAPTSGVYQSPIDCYWSGFRECVLEVSQFL---QH--------NGYQPSFEFAKELDHLVA- 136
            |.....:|....       .|:.:|:.:...||   :|        ..:..:...::.|...|: 
 Frog    80 TKCKQSSSAPQM-------EGYSKCLQDSLHFLSLQKHAELHRKVIQNFHENHSLSQGLCRSVSP 137

  Fly   137 -------STSKSKPNLWRPW 149
                   .|:.....|||||
 Frog   138 YYQTPTIGTAPPAKLLWRPW 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HesrNP_525094.1 HLH 21..77 CDD:238036 19/57 (33%)
Hairy_orange 101..>116 CDD:295407 2/14 (14%)
hes5.5NP_001165751.1 bHLH-O_HES5 23..77 CDD:381467 18/57 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1378299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.